SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG103291_complete:A_BomoIG_DN29868_c11_g1_i5
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)
unconventional_prefoldin_RPB5_interactor-like_protein_[Bombyx_mori]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0001106 F transcription corepressor activity
GO:0001558 P regulation of cell growth
GO:0003682 F chromatin binding
GO:0004864 F protein phosphatase inhibitor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005665 C RNA polymerase II, core complex
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0009615 P response to virus
GO:0010923 P negative regulation of phosphatase activity
GO:0019212 F phosphatase inhibitor activity
GO:0030425 C dendrite
GO:0042995 C cell projection
GO:0043231 C intracellular membrane-bounded organelle
GO:0051219 F phosphoprotein binding
GO:0071363 P cellular response to growth factor stimulus
GO:0071383 P cellular response to steroid hormone stimulus
GO:2001243 P negative regulation of intrinsic apoptotic signaling pathway
RNA-seq EntryA_BomoIG_DN29868_c11_g1_i5
Sequence
(Amino Acid)
MNFLTDIYVKRLAENEKNLQFWVNYLKELRELDLNVFADKLTVPTLVPIGNRILFRGEII
HTNEITVSLGADYFAKCSLKQAEILKQHRIKGNLNSILKSIS
*(33 a.a.)

- SilkBase 1999-2023 -