SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG103092_5prime_partial:A_BomoIG_DN29850_c5_g1_i7
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
1-phosphatidylinositol_3-phosphate_5-kinase_isoform_X1_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0000166 F nucleotide binding
GO:0000285 F 1-phosphatidylinositol-3-phosphate 5-kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005768 C endosome
GO:0005829 C cytosol
GO:0005911 C cell-cell junction
GO:0008270 F zinc ion binding
GO:0010008 C endosome membrane
GO:0012506 C vesicle membrane
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016307 F phosphatidylinositol phosphate kinase activity
GO:0016308 F 1-phosphatidylinositol-4-phosphate 5-kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0030659 C cytoplasmic vesicle membrane
GO:0031410 C cytoplasmic vesicle
GO:0031901 C early endosome membrane
GO:0031902 C late endosome membrane
GO:0032288 P myelin assembly
GO:0032593 C insulin-responsive compartment
GO:0034504 P protein localization to nucleus
GO:0035556 P intracellular signal transduction
GO:0042147 P retrograde transport, endosome to Golgi
GO:0045121 C membrane raft
GO:0046488 P phosphatidylinositol metabolic process
GO:0046854 P phosphatidylinositol phosphate biosynthetic process
GO:0046872 F metal ion binding
GO:0048471 C perinuclear region of cytoplasm
GO:0052810 F 1-phosphatidylinositol-5-kinase activity
GO:2000785 P regulation of autophagosome assembly
RNA-seq EntryA_BomoIG_DN29850_c5_g1_i7
Sequence
(Amino Acid)
AAPAAPVPPRAAPCSCDDKNVCDIEESFIRSMAQCVPWAARGGKSGSTFCKTKDDRFVLK
EMTKPESQQFLDFAPHYFSYVAACREERQPSLLGNVPGSIYLQGSEVRPFV
*(36 a.a.)

- SilkBase 1999-2023 -