| Name | O_BomoIG10283_complete:A_BomoIG_DN33727_c2_g5_i3 |
| Scaffold_id | Bomo_Chr17 |
NCBI non-redundant (nr) | ubiquitin_carboxyl-terminal_hydrolase_nonstop_[Bombyx_mori] |
| Ontology |
| GO:0000124 |
C |
SAGA complex |
| GO:0005515 |
F |
protein binding |
| GO:0005634 |
C |
nucleus |
| GO:0006325 |
P |
chromatin organization |
| GO:0006351 |
P |
transcription, DNA-templated |
| GO:0006355 |
P |
regulation of transcription, DNA-templated |
| GO:0006508 |
P |
proteolysis |
| GO:0006511 |
P |
ubiquitin-dependent protein catabolic process |
| GO:0007411 |
P |
axon guidance |
| GO:0007412 |
P |
axon target recognition |
| GO:0008233 |
F |
peptidase activity |
| GO:0008234 |
F |
cysteine-type peptidase activity |
| GO:0008270 |
F |
zinc ion binding |
| GO:0008347 |
P |
glial cell migration |
| GO:0016568 |
P |
chromatin organization |
| GO:0016578 |
P |
histone deubiquitination |
| GO:0016579 |
P |
protein deubiquitination |
| GO:0016787 |
F |
hydrolase activity |
| GO:0021782 |
P |
glial cell development |
| GO:0036459 |
F |
thiol-dependent deubiquitinase |
| GO:0045893 |
P |
positive regulation of transcription, DNA-templated |
| GO:0046872 |
F |
metal ion binding |
| GO:0071819 |
C |
DUBm complex |
|
| RNA-seq Entry | A_BomoIG_DN33727_c2_g5_i3 |
Sequence (Amino Acid) | MATSCLCFACGQPGPRMHSCLHCIYFACYAGHIQEHSKSKKHFLYVDLSYGNVFCAQCQD
YIYDRELTEIAAIHKAKEAKSLGISIPFMPWLPNHNEAMALRRLRKRRLISPHTTIGLRG
LQNLGSTCFMNCIVQTLIHTPLLRDYFLAEKHKCKSQSSSKCLVCEVSKLFQVIFVLVIL
*(59 a.a.) |