SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG10262_complete:A_BomoIG_DN33769_c1_g1_i2
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)		uncharacterized_protein_LOC101736037_isoform_X1_[Bombyx_mori]
Ontology
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000979 F RNA polymerase II core promoter sequence-specific DNA binding
GO:0001047 F core promoter sequence-specific DNA binding
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0003700 F DNA-binding transcription factor activity
GO:0003713 F transcription coactivator activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006366 P transcription by RNA polymerase II
GO:0006979 P response to oxidative stress
GO:0010038 P response to metal ion
GO:0035035 F histone acetyltransferase binding
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046686 P response to cadmium ion
GO:0046872 F metal ion binding
RNA-seq EntryA_BomoIG_DN33769_c1_g1_i2
Sequence
(Amino Acid)
MAAWLTDSGPSDITEQNNLCTFLVEKSNSNIRADLNLEAFDKEFKRLQPCGFEKSAFVSA
VTSESVYNHNSEVSEGKTHLETHDDSSGMSSIKIDSQKHQMDKNKRKTEDNNARYRCEYD
GCERTYSTVGNLRTHMKTHKGEYRFKCPMQSCEKAFLTSYSLKIHVRAHTKTKPFICDNS
SCGKAFNTLYR
*(63 a.a.)

- SilkBase 1999-2023 -