SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG102549_internal:A_BomoIG_DN9547_c0_g1_i1
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)
PREDICTED:_uncharacterized_protein_LOC106138885,_partial_[Amyelois_transitella]
Ontology
GO:0000166 F nucleotide binding
GO:0000792 C heterochromatin
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0004386 F helicase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0007283 P spermatogenesis
GO:0007399 P nervous system development
GO:0008026 F helicase activity
GO:0008270 F zinc ion binding
GO:0008285 P negative regulation of cell population proliferation
GO:0016020 C membrane
GO:0016568 P chromatin organization
GO:0016581 C NuRD complex
GO:0016787 F hydrolase activity
GO:0016818 F hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0021895 P cerebral cortex neuron differentiation
GO:0030154 P cell differentiation
GO:0035093 P spermatogenesis, exchange of chromosomal proteins
GO:0042826 F histone deacetylase binding
GO:0043967 P histone H4 acetylation
GO:0045595 P regulation of cell differentiation
GO:0046872 F metal ion binding
GO:0060850 P obsolete regulation of transcription involved in cell fate commitment
GO:0061628 F H3K27me3 modified histone binding
GO:0098532 P histone H3-K27 trimethylation
GO:1901798 P positive regulation of signal transduction by p53 class mediator
RNA-seq EntryA_BomoIG_DN9547_c0_g1_i1
Sequence
(Amino Acid)
RDRIAYPACSSCPHPHSPARAIDTHCRDTYVQYENLKMSTDCYACGTCINSPHLMKCSAC
KKCYDLNCLNITTDNFHKLSEQYKTLWVCPSCTCTKPKNSDMNTPI
(34 a.a.)

- SilkBase 1999-2023 -