SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG102524_internal:A_BomoIG_DN25314_c0_g1_i1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)		aspartate_decarboxylase_[Bombyx_mori]
Ontology
GO:0003824 F catalytic activity
GO:0004351 F glutamate decarboxylase activity
GO:0005515 F protein binding
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0006538 P glutamate catabolic process
GO:0006540 P glutamate decarboxylation to succinate
GO:0007268 P chemical synaptic transmission
GO:0007269 P neurotransmitter secretion
GO:0009449 P gamma-aminobutyric acid biosynthetic process
GO:0012506 C vesicle membrane
GO:0016595 F glutamate binding
GO:0016829 F lyase activity
GO:0016831 F carboxy-lyase activity
GO:0018352 P protein-pyridoxal-5-phosphate linkage
GO:0019752 P carboxylic acid metabolic process
GO:0030170 F pyridoxal phosphate binding
GO:0042136 P neurotransmitter biosynthetic process
GO:0042493 P response to xenobiotic stimulus
GO:0046982 F protein heterodimerization activity
GO:0047485 F protein N-terminus binding
GO:0048786 C presynaptic active zone
GO:0061202 C clathrin-sculpted gamma-aminobutyric acid transport vesicle membrane
RNA-seq EntryA_BomoIG_DN25314_c0_g1_i1
Sequence
(Amino Acid)
EVAPVFTLMEEEVLKEMRVLVGWKDGEGDGIFCPGGSIANGYAISCARFHFYPEIKTKGV
YAVPKLTLYTSELAHYSTKKLAAFMGIGDENCVLIKTDKYGKIDVEDLEAKIVEGIEEGA
APFLVTAT
(41 a.a.)

- SilkBase 1999-2023 -