SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG102163_complete:A_BomoIG_DN30764_c4_g1_i1
Scaffold_idBomo_Chr24
NCBI non-redundant
(nr)		GTP_cyclohydrolase_I_isoform_A_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0003824 F catalytic activity
GO:0003934 F GTP cyclohydrolase I activity
GO:0005525 F GTP binding
GO:0005737 C cytoplasm
GO:0006728 P pteridine biosynthetic process
GO:0006729 P tetrahydrobiopterin biosynthetic process
GO:0008152 P metabolic process
GO:0008270 F zinc ion binding
GO:0008363 P larval chitin-based cuticle development
GO:0009880 P embryonic pattern specification
GO:0016787 F hydrolase activity
GO:0035185 P preblastoderm mitotic cell cycle
GO:0035998 P 7,8-dihydroneopterin 3'-triphosphate biosynthetic process
GO:0043095 P regulation of GTP cyclohydrolase I activity
GO:0046654 P tetrahydrofolate biosynthetic process
GO:0046872 F metal ion binding
GO:0048067 P cuticle pigmentation
GO:0048072 P compound eye pigmentation
GO:0060308 F GTP cyclohydrolase I regulator activity
GO:2000274 P regulation of epithelial cell migration, open tracheal system
RNA-seq EntryA_BomoIG_DN30764_c4_g1_i1
Sequence
(Amino Acid)
MVVVKDIEMFSMCEHHLVPFYGKVSIGYLPQGKILGLSKLARIVEIFSRRLQVQERLTKQ
IAIAVTQAVRPAGVAVVIEGVHMCMVMRGVQKINSKTVTSTMLGVFRDDPKTREEFLNLV
HSK
*(40 a.a.)

- SilkBase 1999-2023 -