SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG101884_internal:A_BomoIG_DN30704_c0_g3_i6
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)		PREDICTED:_DNA_excision_repair_protein_haywire_isoform_X1_[Plutella_xylostella]
Ontology
GO:0000166 F nucleotide binding
GO:0000381 P regulation of alternative mRNA splicing, via spliceosome
GO:0000990 F obsolete transcription factor activity, core RNA polymerase binding
GO:0001111 P promoter clearance from RNA polymerase II promoter
GO:0001113 P transcription open complex formation at RNA polymerase II promoter
GO:0003677 F DNA binding
GO:0004003 F DNA helicase activity
GO:0004386 F helicase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005675 C transcription factor TFIIH holo complex
GO:0006281 P DNA repair
GO:0006289 P nucleotide-excision repair
GO:0006366 P transcription by RNA polymerase II
GO:0006367 P transcription initiation from RNA polymerase II promoter
GO:0006974 P cellular response to DNA damage stimulus
GO:0009411 P response to UV
GO:0016787 F hydrolase activity
GO:0032508 P DNA duplex unwinding
GO:0043140 F 3'-5' DNA helicase activity
GO:1903506 P regulation of nucleic acid-templated transcription
RNA-seq EntryA_BomoIG_DN30704_c0_g3_i6
Sequence
(Amino Acid)
DVCSSDLCPMTPEFYREYLVQKINKKMLLYVMNPSKFRACQYLVRYHERRGDKTIVFSDN
VFALRHYAVKMNKPYIYGPTSQSERIQILQNFKFNPKVNTIFVSKVADTSFDLPEANVLI
QISSHGGSRRQEAQRLGRILRAKKGALAEEYNAFFYTLVSQDTLEMAYSRKRQRFLVNQG
YSYKVITELKGMDQEPDMLYGTREEQGTLLSQVLAASETECEEEREGAVGGVS
(76 a.a.)

- SilkBase 1999-2023 -