SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG101871_complete:A_BomoIG_DN30797_c3_g7_i2
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)
cytochrome_P450_18a1_[Bombyx_mori]
Ontology
GO:0004497 F monooxygenase activity
GO:0005506 F iron ion binding
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0006694 P steroid biosynthetic process
GO:0007275 P multicellular organism development
GO:0007304 P chorion-containing eggshell formation
GO:0007480 P imaginal disc-derived leg morphogenesis
GO:0007552 P metamorphosis
GO:0008395 F steroid hydroxylase activity
GO:0009055 F electron transfer activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016491 F oxidoreductase activity
GO:0016705 F oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0020037 F heme binding
GO:0031090 C organelle membrane
GO:0035074 P pupation
GO:0035210 P prepupal development
GO:0043231 C intracellular membrane-bounded organelle
GO:0046344 P ecdysteroid catabolic process
GO:0046872 F metal ion binding
GO:0055114 P obsolete oxidation-reduction process
RNA-seq EntryA_BomoIG_DN30797_c3_g7_i2
Sequence
(Amino Acid)
MDPNLWDEPNKFNPSRFIDATGKIRRPEYFMPFGVGRRMCLGDVLARKEMFMFFSCMMHQ
FDLEMAEGDALPSLEGIVGATIAPKAFRVKFLARSPVPLVPTTLSADSSHLRHVGSH
*(38 a.a.)

- SilkBase 1999-2023 -