SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG101755_complete:A_BomoIG_DN30779_c0_g1_i17
Scaffold_idBomo_Chr3
NCBI non-redundant
(nr)
ubiquitin_carboxyl-terminal_hydrolase_16_[Bombyx_mori]
Ontology
GO:0003713 F transcription coactivator activity
GO:0004197 F cysteine-type endopeptidase activity
GO:0004843 F thiol-dependent deubiquitinase
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006508 P proteolysis
GO:0006511 P ubiquitin-dependent protein catabolic process
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007067 P mitotic cell cycle
GO:0008233 F peptidase activity
GO:0008234 F cysteine-type peptidase activity
GO:0008270 F zinc ion binding
GO:0010468 P regulation of gene expression
GO:0016568 P chromatin organization
GO:0016578 P histone deubiquitination
GO:0016579 P protein deubiquitination
GO:0016787 F hydrolase activity
GO:0035522 P monoubiquitinated histone H2A deubiquitination
GO:0036459 F thiol-dependent deubiquitinase
GO:0042393 F histone binding
GO:0043130 F ubiquitin binding
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045901 P positive regulation of translational elongation
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046872 F metal ion binding
GO:0051289 P protein homotetramerization
GO:0051301 P cell division
GO:0051726 P regulation of cell cycle
GO:0070537 P histone H2A K63-linked deubiquitination
RNA-seq EntryA_BomoIG_DN30779_c0_g1_i17
Sequence
(Amino Acid)
MCLRCGTQLCGRTRNKHALNHFNTPHSDCHALAANSTTWEIYCYNCNNEVTASTAKKLHE
CIEYLKKQFLASSTVKSLPPIELPFETKDFSIIETISKDPLSKGKDKAMVNLGRVRGLSN
LGNTCFFNSVMQCLVQTPYLLKVLQEMSVPGEKFKLPGGKLKLRGDAGELKDVDLPPIAG
QLGEWGTLTRTLAETLEELQGGEGGVYTPRKLLSALVNKLPQFGGGDQHDAHELLRHLLE
AVR
*(80 a.a.)

- SilkBase 1999-2023 -