SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG101525_5prime_partial:A_BomoIG_DN30728_c4_g6_i2
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)		uncharacterized_protein_LOC101739885_isoform_X2_[Bombyx_mori]
Ontology
GO:0002221 P pattern recognition receptor signaling pathway
GO:0002376 P immune system process
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005887 C integral component of plasma membrane
GO:0006508 P proteolysis
GO:0006952 P defense response
GO:0006955 P immune response
GO:0006965 P positive regulation of biosynthetic process of antibacterial peptides active against Gram-positive bacteria
GO:0008063 P Toll signaling pathway
GO:0008233 F peptidase activity
GO:0008270 F zinc ion binding
GO:0008329 F pattern recognition receptor activity
GO:0008592 P regulation of Toll signaling pathway
GO:0008745 F N-acetylmuramoyl-L-alanine amidase activity
GO:0009253 P peptidoglycan catabolic process
GO:0016019 F peptidoglycan immune receptor activity
GO:0016045 P detection of bacterium
GO:0016787 F hydrolase activity
GO:0032494 P response to peptidoglycan
GO:0032500 F muramyl dipeptide binding
GO:0042834 F peptidoglycan binding
GO:0045087 P innate immune response
GO:0050830 P defense response to Gram-positive bacterium
RNA-seq EntryA_BomoIG_DN30728_c4_g6_i2
Sequence
(Amino Acid)
DVCSSDLEKQKYDIPYNFIIGNDNRVYEGRGWGIMGAHTLSYNSCSVGVAFIGDYRELEA
TDLQINRTQMLLDDGVRRGFLHPDYYIVGACDIRETVSPGINLYNALKKLKHFDHSGRFK
HKTCTQIYAMIESEN
*(44 a.a.)

- SilkBase 1999-2023 -