SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG10146_5prime_partial:A_BomoIG_DN33770_c1_g1_i1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)
AP-1_complex_subunit_gamma-1_isoform_X4_[Bombyx_mori]
Ontology
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005802 C trans-Golgi network
GO:0005829 C cytosol
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0008565 F obsolete protein transporter activity
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0017137 F small GTPase binding
GO:0019894 F kinesin binding
GO:0030117 C membrane coat
GO:0030131 C clathrin adaptor complex
GO:0030136 C clathrin-coated vesicle
GO:0030665 C clathrin-coated vesicle membrane
GO:0030742 F GTP-dependent protein binding
GO:0031410 C cytoplasmic vesicle
GO:0035646 P endosome to melanosome transport
GO:0043231 C intracellular membrane-bounded organelle
GO:0043323 P positive regulation of natural killer cell degranulation
GO:0045954 P positive regulation of natural killer cell mediated cytotoxicity
GO:0048471 C perinuclear region of cytoplasm
GO:0055037 C recycling endosome
GO:0090160 P Golgi to lysosome transport
RNA-seq EntryA_BomoIG_DN33770_c1_g1_i1
Sequence
(Amino Acid)
CVSARRAAGAAATLTARATSQLHTLTDFLFQAAVPKKIQLDMMSPSGTTLSPQGEITQVL
KVTNPTKTPLRLRIRVSYNIDGTPVLEQTEINNFPADLFN
*(32 a.a.)

- SilkBase 1999-2023 -