SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG101370_internal:A_BomoIG_DN30783_c3_g4_i3
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
Rho-associated_protein_kinase_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0000166 F nucleotide binding
GO:0001726 C ruffle
GO:0004674 F protein serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0005794 C Golgi apparatus
GO:0005814 C centriole
GO:0005856 C cytoskeleton
GO:0005886 C plasma membrane
GO:0006468 P protein phosphorylation
GO:0007266 P Rho protein signal transduction
GO:0016020 C membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0017048 F small GTPase binding
GO:0017049 F small GTPase binding
GO:0030027 C lamellipodium
GO:0030036 P actin cytoskeleton organization
GO:0032059 C bleb
GO:0040038 P polar body extrusion after meiotic divisions
GO:0042995 C cell projection
GO:0051451 P myoblast migration
GO:0051492 P regulation of stress fiber assembly
GO:0051493 P regulation of cytoskeleton organization
GO:0051894 P positive regulation of focal adhesion assembly
GO:1903431 P positive regulation of cell maturation
GO:2000114 P regulation of establishment of cell polarity
RNA-seq EntryA_BomoIG_DN30783_c3_g4_i3
Sequence
(Amino Acid)
LYQQELRAHQDTQRSQLLSKQEANLELVKRTLEKILKALQTKLNEEKTARQRSESACQEK
DRQMSMLSVDYRQMQQRLQKLEGEHRQESEKVCGLVASLEQERAARLAASGEVSAAEAAA
RT
(39 a.a.)

- SilkBase 1999-2023 -