Name | O_BomoIG100805_complete:A_BomoIG_DN30792_c0_g1_i8 |
Scaffold_id | Bomo_Chr8 |
NCBI non-redundant (nr) | BUB3-interacting_and_GLEBS_motif-containing_protein_ZNF207_isoform_X2_[Bombyx_mori] |
Ontology |
GO:0000070 |
P |
mitotic sister chromatid segregation |
GO:0000775 |
C |
chromosome, centromeric region |
GO:0000776 |
C |
kinetochore |
GO:0000777 |
C |
kinetochore |
GO:0001578 |
P |
microtubule bundle formation |
GO:0005515 |
F |
protein binding |
GO:0005634 |
C |
nucleus |
GO:0005694 |
C |
chromosome |
GO:0005737 |
C |
cytoplasm |
GO:0005819 |
C |
spindle |
GO:0005856 |
C |
cytoskeleton |
GO:0005874 |
C |
microtubule |
GO:0007049 |
P |
cell cycle |
GO:0007059 |
P |
chromosome segregation |
GO:0007067 |
P |
mitotic cell cycle |
GO:0007094 |
P |
mitotic spindle assembly checkpoint signaling |
GO:0008017 |
F |
microtubule binding |
GO:0008608 |
P |
attachment of spindle microtubules to kinetochore |
GO:0046785 |
P |
microtubule polymerization |
GO:0046872 |
F |
metal ion binding |
GO:0050821 |
P |
protein stabilization |
GO:0051301 |
P |
cell division |
GO:0051983 |
P |
regulation of chromosome segregation |
GO:0090307 |
P |
mitotic spindle assembly |
GO:1990047 |
C |
spindle matrix |
|
RNA-seq Entry | A_BomoIG_DN30792_c0_g1_i8 |
Sequence (Amino Acid) | MQVHKEAIDKVPNSLPNRSNIEIEIYGMEGIPPEDVKEHEKQKSGGGKGSDSDDDEPAAK
KKATPALLGAGPSTVSPGILPTPMGPVPPGMYPGHLAMNHMMPPFMQAPRMMMAGMRPLF
PAASAPTSTPSKPTFPAYSNATISAPPTTTTPSSSADLKENGEVKPPAANTCPLVTATGA
GSKIVHPPEDVSLEEIRARHHKYRPAPRPNASPALPPAVSHAEVSC
*(74 a.a.) |