SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG100797_complete:A_BomoIG_DN30792_c0_g1_i5
Scaffold_idBomo_Chr8
NCBI non-redundant
(nr)		Zinc_finger_protein_207_[Papilio_xuthus]
Ontology
GO:0000070 P mitotic sister chromatid segregation
GO:0000775 C chromosome, centromeric region
GO:0000776 C kinetochore
GO:0000777 C kinetochore
GO:0001578 P microtubule bundle formation
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005694 C chromosome
GO:0005737 C cytoplasm
GO:0005819 C spindle
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0007049 P cell cycle
GO:0007059 P chromosome segregation
GO:0007067 P mitotic cell cycle
GO:0007094 P mitotic spindle assembly checkpoint signaling
GO:0008017 F microtubule binding
GO:0008608 P attachment of spindle microtubules to kinetochore
GO:0046785 P microtubule polymerization
GO:0046872 F metal ion binding
GO:0050821 P protein stabilization
GO:0051301 P cell division
GO:0051983 P regulation of chromosome segregation
GO:0090307 P mitotic spindle assembly
GO:1990047 C spindle matrix
RNA-seq EntryA_BomoIG_DN30792_c0_g1_i5
Sequence
(Amino Acid)
MGRKKKKASKPWCWYCNREFDDEKILIQHQKAKHFKCHICHKKLYTGPGLSIHCMQVHKE
AIDKVPNSLPNRSNIEIEIYGMEGIPPEDVKEHEKQKSGINKSFIFFSTETFPLDYVCTF
LLLLCCLGNTHRCLYMFI
*(45 a.a.)

- SilkBase 1999-2023 -