SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG100790_complete:A_BomoIG_DN30792_c0_g6_i1
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)
argonaute_1_[Danaus_plexippus_plexippus]
Ontology
GO:0000932 C P-body
GO:0000956 P nuclear-transcribed mRNA catabolic process
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000993 F RNA polymerase II complex binding
GO:0001047 F core promoter sequence-specific DNA binding
GO:0003676 F nucleic acid binding
GO:0003723 F RNA binding
GO:0003725 F double-stranded RNA binding
GO:0003727 F single-stranded RNA binding
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0005829 C cytosol
GO:0005844 C polysome
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006417 P regulation of translation
GO:0010501 P RNA secondary structure unwinding
GO:0010586 P miRNA metabolic process
GO:0010628 P positive regulation of gene expression
GO:0016442 C RISC complex
GO:0030529 C ribonucleoprotein complex
GO:0031047 P gene silencing by RNA
GO:0031054 P pre-miRNA processing
GO:0035068 C RISC complex
GO:0035196 P production of miRNAs involved in gene silencing by miRNA
GO:0035198 F miRNA binding
GO:0035278 P miRNA-mediated gene silencing by inhibition of translation
GO:0035280 P miRNA loading onto RISC involved in gene silencing by miRNA
GO:0044212 F transcription cis-regulatory region binding
GO:0044822 F RNA binding
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0070578 C RISC-loading complex
RNA-seq EntryA_BomoIG_DN30792_c0_g6_i1
Sequence
(Amino Acid)
MYPVGQPPAGETSGGAVGVAGAVGAPAGTPGAAPVAPSAAPVGAPAPGVAGGAAGLPLVS
PAAAAPPDLPVLTCPRRPNLGHEGRPIMLRANHFQISMPRGFVHHYDVNIQPDKCPRKVK
KELLI
*(41 a.a.)

- SilkBase 1999-2023 -