SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG100675_3prime_partial:A_BomoIG_DN63122_c0_g1_i1
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)		pheromone_biosynthesis_activating_neuropeptide_receptor_isoform_As_[Bombyx_mori]
Ontology
GO:0001607 F neuromedin U receptor activity
GO:0004871 F obsolete signal transducer activity
GO:0004930 F G protein-coupled receptor activity
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006816 P calcium ion transport
GO:0006821 P chloride transport
GO:0007165 P signal transduction
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007200 P phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007202 P activation of phospholipase C activity
GO:0007218 P neuropeptide signaling pathway
GO:0008188 F neuropeptide receptor activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0019722 P calcium-mediated signaling
GO:0048016 P inositol phosphate-mediated signaling
GO:1903955 P positive regulation of protein targeting to mitochondrion
RNA-seq EntryA_BomoIG_DN63122_c0_g1_i1
Sequence
(Amino Acid)
MMADETVNMEMLENNLLNVTNVTDQSSAYSESYPLHLLVPLSVTYAVIFIVGILGNTSTC
VVIARNRSMHTATNFYLFSLAISDIILLVCGLPLELYRLWNPFTYPLGEAQCITIGLASE
TSANATVLTITAFTM
(44 a.a.)

- SilkBase 1999-2023 -