SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG100538_3prime_partial:A_BomoIG_DN31544_c2_g3_i3
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)		protein_unc-13_homolog_A_isoform_X1_[Helicoverpa_armigera]
Ontology
GO:0001956 P positive regulation of neurotransmitter secretion
GO:0005737 C cytoplasm
GO:0005886 C plasma membrane
GO:0006887 P exocytosis
GO:0007268 P chemical synaptic transmission
GO:0007269 P neurotransmitter secretion
GO:0007528 P neuromuscular junction development
GO:0016020 C membrane
GO:0016081 P synaptic vesicle docking
GO:0016188 P synaptic vesicle maturation
GO:0017075 F syntaxin-1 binding
GO:0019992 F diacylglycerol binding
GO:0030054 C cell junction
GO:0030154 P cell differentiation
GO:0030424 C axon
GO:0031594 C neuromuscular junction
GO:0035249 P synaptic transmission, glutamatergic
GO:0035556 P intracellular signal transduction
GO:0042734 C presynaptic membrane
GO:0043005 C neuron projection
GO:0045202 C synapse
GO:0046872 F metal ion binding
GO:0047485 F protein N-terminus binding
GO:0048172 P regulation of short-term neuronal synaptic plasticity
GO:0048786 C presynaptic active zone
GO:0050435 P amyloid-beta metabolic process
GO:0051966 P regulation of synaptic transmission, glutamatergic
GO:0060384 P innervation
GO:1903861 P positive regulation of dendrite extension
RNA-seq EntryA_BomoIG_DN31544_c2_g3_i3
Sequence
(Amino Acid)
MAATKRNAGLTSAVHRATLNDEELKMHVYKKTLQALIYPISSTTPHNFVLWTATSPTYCY
ECEGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQMCFAGAAEKSSKHGAEDKAN
(38 a.a.)

- SilkBase 1999-2023 -