SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG1003_5prime_partial:A_BomoIG_DN30229_c1_g1_i4
Scaffold_idBomo_Chr3
NCBI non-redundant
(nr)
Golgi-specific_brefeldin_A-resistance_guanine_nucleotide_exchange_factor_1,_partial_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0002263 P cell activation involved in immune response
GO:0005085 F guanyl-nucleotide exchange factor activity
GO:0005086 F guanyl-nucleotide exchange factor activity
GO:0005515 F protein binding
GO:0005547 F phosphatidylinositol-3,4,5-trisphosphate binding
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005777 C peroxisome
GO:0005788 C endoplasmic reticulum lumen
GO:0005793 C endoplasmic reticulum-Golgi intermediate compartment
GO:0005794 C Golgi apparatus
GO:0005795 C Golgi stack
GO:0005801 C cis-Golgi network
GO:0005802 C trans-Golgi network
GO:0005811 C lipid droplet
GO:0005829 C cytosol
GO:0006810 P transport
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006890 P retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0006892 P post-Golgi vesicle-mediated transport
GO:0006895 P Golgi to endosome transport
GO:0007030 P Golgi organization
GO:0007346 P regulation of mitotic cell cycle
GO:0008289 F lipid binding
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016032 P viral process
GO:0030593 P neutrophil chemotaxis
GO:0031252 C cell leading edge
GO:0032012 P regulation of ARF protein signal transduction
GO:0034067 P protein localization to Golgi apparatus
GO:0042147 P retrograde transport, endosome to Golgi
GO:0043547 P positive regulation of GTPase activity
GO:0048205 P COPI coating of Golgi vesicle
GO:0061162 P establishment of monopolar cell polarity
GO:0070973 P protein localization to endoplasmic reticulum exit site
GO:0080025 F phosphatidylinositol-3,5-bisphosphate binding
GO:0090166 P Golgi disassembly
GO:0097111 P endoplasmic reticulum-Golgi intermediate compartment organization
GO:1903409 P reactive oxygen species biosynthetic process
GO:1903420 P protein localization to endoplasmic reticulum tubular network
GO:2000008 P regulation of protein localization to cell surface
RNA-seq EntryA_BomoIG_DN30229_c1_g1_i4
Sequence
(Amino Acid)
DPAVLQRCVETLALVVRDLAHVTPYNCRATVAALRIVARAAMRHGQEKSRDDIKSRSGSS
RTRDDSSDEETEDVDQYHLISIQVLDLMHTLHSRTAQIFAWWRDEAEQRGPADHDLWDIA
WSPLLQAIALFCTDRRKQVSRCAMRYLQRALLAPGLSSMGGEAWEACFYSVLFPLLGGLG
RRPDAAARANTLTCKVLLQHLAALACRPTFSRLWTRMLHVQRSLLQTQHDALAEAALESL
KNVILVMDSVHVSPTLCLVPAAPSALARHTCLLRL
*(91 a.a.)

- SilkBase 1999-2023 -