SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoIG100398_complete:A_BomoIG_DN31548_c4_g6_i2
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)		upf3_regulator_of_nonsense_transcripts-like_protein_B_isoform_X1_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000184 P nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000398 P mRNA splicing, via spliceosome
GO:0003723 F RNA binding
GO:0003729 F mRNA binding
GO:0005487 F structural constituent of nuclear pore
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005730 C nucleolus
GO:0005737 C cytoplasm
GO:0005815 C microtubule organizing center
GO:0005829 C cytosol
GO:0006369 P termination of RNA polymerase II transcription
GO:0006405 P RNA export from nucleus
GO:0006406 P mRNA export from nucleus
GO:0006810 P transport
GO:0031124 P mRNA 3'-end processing
GO:0035145 C exon-exon junction complex
GO:0044822 F RNA binding
GO:0045727 P positive regulation of translation
GO:0051028 P mRNA transport
RNA-seq EntryA_BomoIG_DN31548_c4_g6_i2
Sequence
(Amino Acid)
MTEDQDGKDSQSDSGSKTFINKSKDKKSKIHRPLTKIILRRLPPTMTEETFLEQVSPIPE
HDYFYFAKPDPTLGNNLFSRAYINFVNVEDIFLFRDKFDGYVFLDEKGVY
*(36 a.a.)

- SilkBase 1999-2023 -