Name | O_BomoIG100179_3prime_partial:A_BomoIG_DN31567_c2_g4_i5 |
Scaffold_id | Bomo_Chr19 |
NCBI non-redundant (nr) | cleavage_and_polyadenylation_specificity_factor_73_[Bombyx_mori] |
Ontology |
GO:0003677 |
F |
DNA binding |
GO:0003723 |
F |
RNA binding |
GO:0004518 |
F |
nuclease activity |
GO:0004519 |
F |
endonuclease activity |
GO:0005515 |
F |
protein binding |
GO:0005634 |
C |
nucleus |
GO:0005847 |
C |
mRNA cleavage and polyadenylation specificity factor complex |
GO:0006378 |
P |
mRNA polyadenylation |
GO:0006379 |
P |
mRNA cleavage |
GO:0006397 |
P |
mRNA processing |
GO:0006398 |
P |
mRNA 3'-end processing by stem-loop binding and cleavage |
GO:0016787 |
F |
hydrolase activity |
GO:0022008 |
P |
neurogenesis |
GO:0046872 |
F |
metal ion binding |
|
RNA-seq Entry | A_BomoIG_DN31567_c2_g4_i5 |
Sequence (Amino Acid) | MYADALVGAALSAAALAAPAATHPPLAPKLDRMHFKECVIEMFQDMFGEDSVPKMFKGDK
LYVTVDDKRADIDLQSMEVRCPEEPSLASCVRSALQHLHAALSPVRPPPGAPP
(36 a.a.) |