SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoIG100156_5prime_partial:A_BomoIG_DN31567_c2_g4_i3
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)
delta(24)-sterol_reductase_[Bombyx_mori]
Ontology
GO:0000139 C Golgi membrane
GO:0003824 F catalytic activity
GO:0005634 C nucleus
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0006629 P lipid metabolic process
GO:0006694 P steroid biosynthetic process
GO:0006695 P cholesterol biosynthetic process
GO:0006979 P response to oxidative stress
GO:0008202 P steroid metabolic process
GO:0008203 P cholesterol metabolic process
GO:0009888 P tissue development
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016126 P sterol biosynthetic process
GO:0016491 F oxidoreductase activity
GO:0016614 F oxidoreductase activity, acting on CH-OH group of donors
GO:0019899 F enzyme binding
GO:0042605 F peptide antigen binding
GO:0043066 P negative regulation of apoptotic process
GO:0043154 P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043588 P skin development
GO:0050614 F delta24-sterol reductase activity
GO:0050660 F flavin adenine dinucleotide binding
GO:0055114 P obsolete oxidation-reduction process
RNA-seq EntryA_BomoIG_DN31567_c2_g4_i3
Sequence
(Amino Acid)
VRAYTFTKQVFQDIVLPISELERQIEMATQLFDKFPLLVYPCKVIDRGPSSGQLKRPHSK
YLVPGTNYAMYNDLGVYGVPGKVKEKKPYSPVTAMRKMEEFTREVGGFSFLYADIFMTRE
EFEAMFDLSLYERVRRKYGAEGAFPHLYVKVKPEIDVFAIGEENAVQ
*(55 a.a.)

- SilkBase 1999-2023 -