SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB287_5prime_partial:A_BomoFB_comp1041_c0_seq1
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)
PREDICTED:_cadherin-23_[Bombyx_mori]
Ontology
GO:0001658 P branching involved in ureteric bud morphogenesis
GO:0001736 P establishment of planar polarity
GO:0001822 P kidney development
GO:0003007 P heart morphogenesis
GO:0003183 P mitral valve morphogenesis
GO:0003192 P mitral valve formation
GO:0003273 P cell migration involved in endocardial cushion formation
GO:0003674 F molecular_function
GO:0005509 F calcium ion binding
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0007155 P cell adhesion
GO:0007156 P homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007157 P heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0007389 P pattern specification process
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016477 P cell migration
GO:0021915 P neural tube development
GO:0022008 P neurogenesis
GO:0035329 P hippo signaling
GO:0036342 P post-anal tail morphogenesis
GO:0043931 P ossification involved in bone maturation
GO:0045177 C apical part of cell
GO:0048565 P digestive tract development
GO:0072006 P nephron development
GO:0072137 P condensed mesenchymal cell proliferation
GO:0072659 P protein localization to plasma membrane
GO:0090102 P cochlea development
GO:0098609 P cell-cell adhesion
RNA-seq EntryA_BomoFB_comp1041_c0_seq1
Sequence
(Amino Acid)
RDLGTPANAVRGELRVCVTDYNDHAPVFVHPQQNVTIKVPENATIGTTIIEAKAIDADIG
PNGAVRYRLRRDAGGSWRAFSLHATSGALRTLIPLDRDKQTTYQLRIEAYDLGLPTPLSS
DLDLTVYVQRR
*(43 a.a.)

- SilkBase 1999-2023 -