SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB20431_3prime_partial:A_BomoFB_comp127180_c0_seq1
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)
Ontology
GO:0000209 P protein polyubiquitination
GO:0004842 F ubiquitin-protein transferase activity
GO:0005128 F erythropoietin receptor binding
GO:0005135 F interleukin-3 receptor binding
GO:0005515 F protein binding
GO:0005575 C cellular_component
GO:0006914 P autophagy
GO:0006915 P apoptotic process
GO:0008270 F zinc ion binding
GO:0008285 P negative regulation of cell population proliferation
GO:0010468 P regulation of gene expression
GO:0010498 P proteasomal protein catabolic process
GO:0016567 P protein ubiquitination
GO:0016874 F ligase activity
GO:0016881 F acid-amino acid ligase activity
GO:0017160 F small GTPase binding
GO:0030336 P negative regulation of cell migration
GO:0031386 F protein tag
GO:0043408 P regulation of MAPK cascade
GO:0045619 P regulation of lymphocyte differentiation
GO:0045637 P regulation of myeloid cell differentiation
GO:0046872 F metal ion binding
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0051865 P protein autoubiquitination
GO:0051896 P regulation of protein kinase B signaling
GO:0061630 F ubiquitin protein ligase activity
GO:0097191 P extrinsic apoptotic signaling pathway
GO:2000114 P regulation of establishment of cell polarity
GO:2000377 P regulation of reactive oxygen species metabolic process
GO:2000379 P positive regulation of reactive oxygen species metabolic process
RNA-seq EntryA_BomoFB_comp127180_c0_seq1
Sequence
(Amino Acid)
MGFEIKRFQGDVDEELICPICSGVLEDPLQAPACEHAFCRACITEWISRQPTCPVDRQTV
TASQLRPVPRILRNLLSRLCTSCDNAPHGCNAILKLDSLPNHLVECEFNPKRPIPCEAGC
GLVIPKDELAQHNCVRELRALIATQQGKLNDYQQELAEQRLVINEHKRELALLKEFMRAM
RVSNPTMRALADQMEREEVVRWANSLARARV
(69 a.a.)

- SilkBase 1999-2023 -