SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB20303_5prime_partial:A_BomoFB_comp121586_c0_seq1
Scaffold_idBomo_Chr23
NCBI non-redundant
(nr)
Ontology
GO:0001932 P regulation of protein phosphorylation
GO:0003779 F actin binding
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005794 C Golgi apparatus
GO:0005829 C cytosol
GO:0005886 C plasma membrane
GO:0006260 P DNA replication
GO:0006275 P regulation of DNA replication
GO:0007399 P nervous system development
GO:0008017 F microtubule binding
GO:0010975 P regulation of neuron projection development
GO:0016020 C membrane
GO:0016023 C cytoplasmic vesicle
GO:0016477 P cell migration
GO:0030027 C lamellipodium
GO:0030032 P lamellipodium assembly
GO:0031410 C cytoplasmic vesicle
GO:0031929 P TOR signaling
GO:0032148 P activation of protein kinase B activity
GO:0032956 P regulation of actin cytoskeleton organization
GO:0035091 F phosphatidylinositol binding
GO:0042127 P regulation of cell population proliferation
GO:0042803 F protein homodimerization activity
GO:0042995 C cell projection
GO:0043422 F protein kinase B binding
GO:0061024 P membrane organization
RNA-seq EntryA_BomoFB_comp121586_c0_seq1
Sequence
(Amino Acid)
LRAEHSKLKDDFRNLFTASDRLKNEYRNMQEEYRKLRSEVSHLKLLNTEISGEVNTKVEI
ITSLELEINKTNQHCEMLIQMNKSLDADRRSLMDHVSQLLTQYHELLAHSLKDKQHYHEE
EKMFADKVNALCRQKEKLEEKNNGTL
*(48 a.a.)

- SilkBase 1999-2023 -