SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoFB20274_3prime_partial:A_BomoFB_comp121118_c0_seq1
Scaffold_idBomo_Chr19
NCBI non-redundant
(nr)
Ontology
GO:0001568 P blood vessel development
GO:0001702 P gastrulation with mouth forming second
GO:0001933 P negative regulation of protein phosphorylation
GO:0005178 F integrin binding
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006644 P phospholipid metabolic process
GO:0007155 P cell adhesion
GO:0008195 F phosphatidate phosphatase activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016337 P cell-cell adhesion
GO:0016787 F hydrolase activity
GO:0030111 P regulation of Wnt signaling pathway
GO:0034109 P homotypic cell-cell adhesion
GO:0042392 F sphingosine-1-phosphate phosphatase activity
GO:0042577 F lipid phosphatase activity
GO:0044328 P canonical Wnt signaling pathway involved in positive regulation of endothelial cell migration
GO:0044329 P canonical Wnt signaling pathway involved in positive regulation of cell-cell adhesion
GO:0044330 P canonical Wnt signaling pathway involved in positive regulation of wound healing
GO:0046839 P phospholipid dephosphorylation
GO:0050731 P positive regulation of peptidyl-tyrosine phosphorylation
GO:0050821 P protein stabilization
GO:0051091 P positive regulation of DNA-binding transcription factor activity
GO:0060020 P Bergmann glial cell differentiation
GO:0060070 P canonical Wnt signaling pathway
GO:0070062 C extracellular exosome
GO:1902068 P regulation of sphingolipid mediated signaling pathway
RNA-seq EntryA_BomoFB_comp121118_c0_seq1
Sequence
(Amino Acid)
MQAKHSVLWHLLIDLPIVLLVAAVCICLEVGALPSRRSGFTCNDPALSFPHTGDTFSISL
VAAITVIVPFFVLWAVEAMLYQDDEYNMKKRKMLASAKTAGLIYRDYIYGAVVNLTILEV
VKCVVGTPRPTFFDLCQPDKALTCNDSEYVSSYKCTSTQYSRYLQIDSSRSFPSAHASLS
VYCGLFLAWYLQRRAFSWHNRSVLLI
(67 a.a.)

- SilkBase 1999-2023 -