| Name | O_BomoFB20160_5prime_partial:A_BomoFB_comp117819_c0_seq1 |
| Scaffold_id | Bomo_Chr8 |
NCBI non-redundant (nr) | |
| Ontology |
| GO:0000166 |
F |
nucleotide binding |
| GO:0003774 |
F |
cytoskeletal motor activity |
| GO:0003779 |
F |
actin binding |
| GO:0005516 |
F |
calmodulin binding |
| GO:0005524 |
F |
ATP binding |
| GO:0005737 |
C |
cytoplasm |
| GO:0005903 |
C |
brush border |
| GO:0005938 |
C |
cell cortex |
| GO:0007368 |
P |
determination of left/right symmetry |
| GO:0007498 |
P |
mesoderm development |
| GO:0008152 |
P |
metabolic process |
| GO:0016459 |
C |
myosin complex |
| GO:0031941 |
C |
filamentous actin |
| GO:0032528 |
P |
microvillus organization |
| GO:0042623 |
F |
ATP hydrolysis activity |
| GO:0042742 |
P |
defense response to bacterium |
| GO:0048803 |
P |
imaginal disc-derived male genitalia morphogenesis |
| GO:0071907 |
P |
determination of digestive tract left/right asymmetry |
|
| RNA-seq Entry | A_BomoFB_comp117819_c0_seq1 |
Sequence (Amino Acid) | RRTFRLKHRLPLDRLTVVVTNESDSLLLVKVPRDLKKDKGDLIISVTHLIEALTIVTDYT
KKPELIEIVDTRTIAHSLVNGKQGGTIEVTKGTQPAIQRAKSGNLLVVATP
*(36 a.a.) |