SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB20125_5prime_partial:A_BomoFB_comp116302_c0_seq1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
Ontology
GO:0000023 P maltose metabolic process
GO:0002026 P regulation of the force of heart contraction
GO:0002086 P diaphragm contraction
GO:0003007 P heart morphogenesis
GO:0003824 F catalytic activity
GO:0004553 F hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004558 F alpha-1,4-glucosidase activity
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005975 P carbohydrate metabolic process
GO:0005977 P glycogen metabolic process
GO:0005980 P glycogen catabolic process
GO:0006941 P striated muscle contraction
GO:0007040 P lysosome organization
GO:0007626 P locomotory behavior
GO:0008152 P metabolic process
GO:0009888 P tissue development
GO:0016020 C membrane
GO:0016787 F hydrolase activity
GO:0016798 F hydrolase activity, acting on glycosyl bonds
GO:0030246 F carbohydrate binding
GO:0032450 F maltose alpha-glucosidase activity
GO:0043181 P vacuolar sequestering
GO:0046716 P muscle cell cellular homeostasis
GO:0050884 P neuromuscular process controlling posture
GO:0050885 P neuromuscular process controlling balance
GO:0060048 P cardiac muscle contraction
GO:0070062 C extracellular exosome
RNA-seq EntryA_BomoFB_comp116302_c0_seq1
Sequence
(Amino Acid)
LAAPDAAAAASGRLYWDDGDSLHTYEEKKYSYIEFSLNGTEIQSHVKWWGYGVPLFNQLS
ILNQPPVKQVLINGMPCVSPCSFTYYKKNKVLSIMINLSLEKPFNVRWSYDEKYLNRTGA
SRKN
*(40 a.a.)

- SilkBase 1999-2023 -