SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB19899_3prime_partial:A_BomoFB_comp110122_c0_seq1
Scaffold_idBomo_Chr9
NCBI non-redundant
(nr)
Ontology
GO:0001752 P compound eye photoreceptor fate commitment
GO:0002121 P inter-male aggressive behavior
GO:0003676 F nucleic acid binding
GO:0003677 F DNA binding
GO:0005515 F protein binding
GO:0005575 C cellular_component
GO:0005634 C nucleus
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0007219 P Notch signaling pathway
GO:0007275 P multicellular organism development
GO:0007420 P brain development
GO:0007424 P open tracheal system development
GO:0007430 P terminal branching, open tracheal system
GO:0008056 P ocellus development
GO:0008283 P cell population proliferation
GO:0010629 P negative regulation of gene expression
GO:0035214 P eye-antennal disc development
GO:0035218 P leg disc development
GO:0035220 P wing disc development
GO:0046872 F metal ion binding
RNA-seq EntryA_BomoFB_comp110122_c0_seq1
Sequence
(Amino Acid)
MVVLEDGGMMATNPNQYLQPDYLAPLPSTLDSKKSPLALLAQTCSQIGVDSTPSKPLLPP
HDKKKVNSVNNSDIISRSSPNSNTMKQDKPRSSPESKHLAFKPYEA
(34 a.a.)

- SilkBase 1999-2023 -