SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB19891_5prime_partial:A_BomoFB_comp109926_c0_seq1
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)
Ontology
GO:0005575 C cellular_component
GO:0005737 C cytoplasm
GO:0005764 C lysosome
GO:0005765 C lysosomal membrane
GO:0005768 C endosome
GO:0005769 C early endosome
GO:0005770 C late endosome
GO:0006810 P transport
GO:0006904 P vesicle docking involved in exocytosis
GO:0007032 P endosome organization
GO:0008150 P biological_process
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0019905 F syntaxin binding
GO:0030123 C AP-3 adaptor complex
GO:0030136 C clathrin-coated vesicle
GO:0030348 F syntaxin-3 binding
GO:0030897 C HOPS complex
GO:0031091 C platelet alpha granule
GO:0031410 C cytoplasmic vesicle
GO:0031901 C early endosome membrane
GO:0031902 C late endosome membrane
GO:0032400 P melanosome localization
GO:0032418 P lysosome localization
GO:0035855 P megakaryocyte development
GO:0048471 C perinuclear region of cytoplasm
GO:0055037 C recycling endosome
GO:0061025 P membrane fusion
GO:0070889 P platelet alpha granule organization
GO:0071439 C clathrin complex
GO:0090330 P regulation of platelet aggregation
RNA-seq EntryA_BomoFB_comp109926_c0_seq1
Sequence
(Amino Acid)
LTQGLSYDEYNTLVNKYLLAFGYKYLYVFNNLINSGLLIQPSNIKLSLNISNLSNLSDKL
PKWQNEFQTAAHKLKQLPSKPDDVGKSSPSYVFNGGYIPLVAIICNAILTSESLSEVLTK
LSTLTDFKIGGVINEKLKDGVETLNEKLSNLKVSNDLEFGCKDPKILSKVVKSDPNFCNL
FQLKPKTILVFVIGGVNYAEIAACEVVQTNTGSKIYIASDCVSNGSDLIAAHM
*(77 a.a.)

- SilkBase 1999-2023 -