SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoFB19854_3prime_partial:A_BomoFB_comp109479_c0_seq1
Scaffold_idBomo_Chr22
NCBI non-redundant
(nr)
Ontology
GO:0004605 F phosphatidate cytidylyltransferase activity
GO:0005635 C nuclear envelope
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005790 C smooth endoplasmic reticulum
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0006629 P lipid metabolic process
GO:0006655 P phosphatidylglycerol biosynthetic process
GO:0007430 P terminal branching, open tracheal system
GO:0007601 P visual perception
GO:0007602 P phototransduction
GO:0008654 P phospholipid biosynthetic process
GO:0010883 P regulation of lipid storage
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016024 P CDP-diacylglycerol biosynthetic process
GO:0016049 P cell growth
GO:0016056 P rhodopsin mediated signaling pathway
GO:0016740 F transferase activity
GO:0016772 F transferase activity, transferring phosphorus-containing groups
GO:0016779 F nucleotidyltransferase activity
GO:0019915 P lipid storage
GO:0043052 P thermotaxis
GO:0050896 P response to stimulus
GO:0060439 P trachea morphogenesis
RNA-seq EntryA_BomoFB_comp109479_c0_seq1
Sequence
(Amino Acid)
MSEIRQRRGDGDGNQKIEAAVESDHVDSEEEKVLEEKYVDELAKSLPQGTDKTPEILDSA
LSGLSTRWRNWVIRGIFTWLMIGGFCLLIYGGPLALMITVLCVQVKCFEEIINIGYAVYR
VHGLPWFRSLSWYFLLTSNYFFYGENLIDYFGVVINRTDYLKFLVTYHRFISFSLYCVGF
VWFVLSLAKRY
(62 a.a.)

- SilkBase 1999-2023 -