SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoFB19829_3prime_partial:A_BomoFB_comp109110_c0_seq1
Scaffold_idBomo_Chr21
NCBI non-redundant
(nr)
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0002376 P immune system process
GO:0002385 P mucosal immune response
GO:0003677 F DNA binding
GO:0004843 F thiol-dependent deubiquitinase
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006508 P proteolysis
GO:0006955 P immune response
GO:0008233 F peptidase activity
GO:0008234 F cysteine-type peptidase activity
GO:0008270 F zinc ion binding
GO:0016579 P protein deubiquitination
GO:0016787 F hydrolase activity
GO:0032717 P negative regulation of interleukin-8 production
GO:0035871 P protein K11-linked deubiquitination
GO:0036459 F thiol-dependent deubiquitinase
GO:0043124 P negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0046872 F metal ion binding
GO:0070530 F K63-linked polyubiquitin modification-dependent protein binding
GO:0070536 P protein K63-linked deubiquitination
GO:0071108 P protein K48-linked deubiquitination
GO:0071947 P protein deubiquitination involved in ubiquitin-dependent protein catabolic process
GO:1900181 P negative regulation of protein localization to nucleus
GO:1990380 F Lys48-specific deubiquitinase activity
RNA-seq EntryA_BomoFB_comp109110_c0_seq1
Sequence
(Amino Acid)
MVMEADPIAEKRNDERVHSAPLKARAGGDVMGERSVDTLDMAFTGPSNLVLTPAPECRKL
SRGISRATDNEGLVWALRNNTDPEPSTLSSDHILLLPDITVYPPDFRTFLEKDLLETATL
VTLETANILNWWCHGRVPGAPRLLPLATSGDGNCLPHAASLAAYGFHDRLLALRTKVQAL
LSGEYGETITNAIRRRWRWSESASLCAAGLVP
(69 a.a.)

- SilkBase 1999-2023 -