SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoFB19736_3prime_partial:A_BomoFB_comp106348_c0_seq1
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)
Ontology
GO:0001701 P in utero embryonic development
GO:0001736 P establishment of planar polarity
GO:0001822 P kidney development
GO:0001889 P liver development
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005813 C centrosome
GO:0005815 C microtubule organizing center
GO:0005856 C cytoskeleton
GO:0005911 C cell-cell junction
GO:0005923 C bicellular tight junction
GO:0005929 C cilium
GO:0005930 C axoneme
GO:0007163 P establishment or maintenance of cell polarity
GO:0007368 P determination of left/right symmetry
GO:0007420 P brain development
GO:0008589 P regulation of smoothened signaling pathway
GO:0021532 P neural tube patterning
GO:0021537 P telencephalon development
GO:0021549 P cerebellum development
GO:0021670 P lateral ventricle development
GO:0021772 P olfactory bulb development
GO:0022038 P corpus callosum development
GO:0030054 C cell junction
GO:0031870 F thromboxane A2 receptor binding
GO:0035108 P limb morphogenesis
GO:0035115 P embryonic forelimb morphogenesis
GO:0035116 P embryonic hindlimb morphogenesis
GO:0035869 C ciliary transition zone
GO:0036064 C ciliary basal body
GO:0042384 P cilium assembly
GO:0042995 C cell projection
GO:0043010 P camera-type eye development
GO:0043584 P nose development
GO:0044767 P developmental process
GO:0045744 P negative regulation of G protein-coupled receptor signaling pathway
GO:0060039 P pericardium development
GO:0060271 P cilium assembly
GO:0060322 P head development
GO:0090102 P cochlea development
RNA-seq EntryA_BomoFB_comp106348_c0_seq1
Sequence
(Amino Acid)
MNCNNTEQNGRDIVCKTHTSRSERELYRTCPTKLSKRELEDLYFALVDNNMSLKKTVNEQ
RDTIKILNTKVQRLSTARKNIYGKEQNDCCRSVKVMVNEQKELIVELKRENTRLCERVRL
LNMRLCSAKQFTKRSPLQARCTRCSVIPTNSLKNASTSALCLKISDTNLKSAAVSCINTP
NESAHSNSTVDTEDEVPEKVDRPEQQCNDNRCRTLIEELEQRIVRLDKEVSAAREDYAIR
ISSLETEGRGAREEGARL
(85 a.a.)

- SilkBase 1999-2023 -