SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB19684_internal:A_BomoFB_comp105251_c0_seq1
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)
Ontology
GO:0000165 P MAPK cascade
GO:0000186 P obsolete activation of MAPKK activity
GO:0000187 P obsolete activation of MAPK activity
GO:0001702 P gastrulation with mouth forming second
GO:0001759 P organ induction
GO:0002088 P lens development in camera-type eye
GO:0003281 P ventricular septum development
GO:0005068 F transmembrane receptor protein tyrosine kinase adaptor activity
GO:0005088 F guanyl-nucleotide exchange factor activity
GO:0005104 F fibroblast growth factor receptor binding
GO:0005158 F insulin receptor binding
GO:0005168 F neurotrophin TRKA receptor binding
GO:0005515 F protein binding
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005911 C cell-cell junction
GO:0007169 P transmembrane receptor protein tyrosine kinase signaling pathway
GO:0007185 P transmembrane receptor protein tyrosine phosphatase signaling pathway
GO:0007186 P G protein-coupled receptor signaling pathway
GO:0007405 P neuroblast proliferation
GO:0008543 P fibroblast growth factor receptor signaling pathway
GO:0008595 P anterior/posterior axis specification, embryo
GO:0012505 C endomembrane system
GO:0014066 P regulation of phosphatidylinositol 3-kinase signaling
GO:0016020 C membrane
GO:0016303 F 1-phosphatidylinositol-3-kinase activity
GO:0019211 F phosphatase activator activity
GO:0030900 P forebrain development
GO:0036092 P phosphatidylinositol-3-phosphate biosynthetic process
GO:0042981 P regulation of apoptotic process
GO:0043547 P positive regulation of GTPase activity
GO:0046619 P lens placode formation involved in camera-type eye formation
GO:0046854 P phosphatidylinositol phosphate biosynthetic process
GO:0046934 F phosphatidylinositol-4,5-bisphosphate 3-kinase activity
GO:0048015 P phosphatidylinositol-mediated signaling
GO:0050678 P regulation of epithelial cell proliferation
GO:0060527 P prostate epithelial cord arborization involved in prostate glandular acinus morphogenesis
GO:0070307 P lens fiber cell development
GO:0070372 P regulation of ERK1 and ERK2 cascade
RNA-seq EntryA_BomoFB_comp105251_c0_seq1
Sequence
(Amino Acid)
GLSQNKILVYMTIVQFCIFVMGCLHSKKEPSELHPNVFRVVNIDENGDDLCSGQLEITES
DIILYRVGRDSTVWPLHSLRRYGFEGDLFSFESGRRCETGEGIYAFKCRRASLLFRKLQQ
QIQLRNIVHDSVAYPGSRLTPPPQGRQTLQATVIHRSSIDNGQPEAQSAIIHNLSNITSN
SDVLRHVNLNTTPRSPSNADILEVTPLYPRPQSSSSHVTNVYQFSEFKREHNNNQNETAV
DSRHVYCNDLNRDLAVLRSTLKQT
(87 a.a.)

- SilkBase 1999-2023 -