SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB19548_3prime_partial:A_BomoFB_comp102626_c0_seq1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
Ontology
GO:0000165 P MAPK cascade
GO:0000166 F nucleotide binding
GO:0000187 P obsolete activation of MAPK activity
GO:0001736 P establishment of planar polarity
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0004702 F obsolete signal transducer, downstream of receptor, with serine/threonine kinase activity
GO:0004708 F MAP kinase kinase activity
GO:0004713 F protein tyrosine kinase activity
GO:0005078 F MAP-kinase scaffold activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005737 C cytoplasm
GO:0006357 P regulation of transcription by RNA polymerase II
GO:0006468 P protein phosphorylation
GO:0007254 P JNK cascade
GO:0007257 P obsolete activation of JUN kinase activity
GO:0007275 P multicellular organism development
GO:0007298 P border follicle cell migration
GO:0007391 P dorsal closure
GO:0007395 P dorsal closure, spreading of leading edge cells
GO:0007411 P axon guidance
GO:0007561 P imaginal disc eversion
GO:0008340 P determination of adult lifespan
GO:0008545 F JUN kinase kinase activity
GO:0009408 P response to heat
GO:0010508 P positive regulation of autophagy
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0018108 P peptidyl-tyrosine phosphorylation
GO:0019901 F protein kinase binding
GO:0030032 P lamellipodium assembly
GO:0030381 P chorion-containing eggshell pattern formation
GO:0030424 C axon
GO:0030707 P ovarian follicle cell development
GO:0033500 P carbohydrate homeostasis
GO:0034769 P basement membrane disassembly
GO:0035006 P melanization defense response
GO:0042060 P wound healing
GO:0043507 P positive regulation of JUN kinase activity
GO:0043652 P engulfment of apoptotic cell
GO:0045610 P regulation of hemocyte differentiation
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046330 P positive regulation of JNK cascade
GO:0046528 P imaginal disc fusion
GO:0046529 P imaginal disc fusion, thorax closure
GO:0046843 P dorsal appendage formation
GO:0046844 P chorion micropyle formation
GO:0046847 P filopodium assembly
GO:0048666 P neuron development
GO:0048675 P axon extension
GO:0051017 P actin filament bundle assembly
GO:0070328 P triglyceride homeostasis
GO:0071243 P cellular response to arsenic-containing substance
GO:0071276 P cellular response to cadmium ion
RNA-seq EntryA_BomoFB_comp102626_c0_seq1
Sequence
(Amino Acid)
MSNSSIEGKIQGLQERLDEMRIRREGGLSSQGGIGTARPGNVPPNRVRPKLPPMFSIPAF
PPRTPQVTDTENRMREVYKVSGKLSVDGKEYKSSIDELQHLGELGSGTCGHVVKMLHKPS
SAVIAVKQMRRSGNSEETKRILMDLDVVVRSHDCPYIVRCLGCFVTDADVWICME
(57 a.a.)

- SilkBase 1999-2023 -