SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoFB19459_internal:A_BomoFB_comp100554_c0_seq1
Scaffold_idBomo_Chr12
NCBI non-redundant
(nr)
Ontology
GO:0000075 P cell cycle checkpoint signaling
GO:0000077 P DNA damage checkpoint signaling
GO:0000166 F nucleotide binding
GO:0001700 P embryonic development via the syncytial blastoderm
GO:0004672 F protein kinase activity
GO:0004674 F protein serine/threonine kinase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005829 C cytosol
GO:0006468 P protein phosphorylation
GO:0006974 P cellular response to DNA damage stimulus
GO:0007049 P cell cycle
GO:0007050 P regulation of cell cycle
GO:0007093 P mitotic cell cycle checkpoint signaling
GO:0007095 P mitotic G2 DNA damage checkpoint signaling
GO:0007275 P multicellular organism development
GO:0007348 P regulation of syncytial blastoderm mitotic cell cycle
GO:0007349 P cellularization
GO:0007444 P imaginal disc development
GO:0009314 P response to radiation
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016321 P female meiosis chromosome segregation
GO:0016740 F transferase activity
GO:0033314 P mitotic DNA replication checkpoint signaling
GO:0042060 P wound healing
GO:0051225 P spindle assembly
GO:0051299 P centrosome separation
RNA-seq EntryA_BomoFB_comp100554_c0_seq1
Sequence
(Amino Acid)
REAALQRALRHPHVLRCLGERTHLQHHYVFLEYAQGGELFDRIEPDVGMDSDTARRYWRE
TLSGLEYLHARGVAHRDIKPENLLLDHHDRVKISDFGLATVFRHGGRERMLSRVCGTPPY
AA
(39 a.a.)

- SilkBase 1999-2023 -