SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB19449_3prime_partial:A_BomoFB_comp100437_c0_seq1
Scaffold_idBomo_Chr10
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0000226 P microtubule cytoskeleton organization
GO:0000287 F magnesium ion binding
GO:0003924 F GTPase activity
GO:0005509 F calcium ion binding
GO:0005515 F protein binding
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005739 C mitochondrion
GO:0005741 C mitochondrial outer membrane
GO:0005829 C cytosol
GO:0007005 P mitochondrion organization
GO:0007165 P signal transduction
GO:0007264 P small GTPase mediated signal transduction
GO:0007268 P chemical synaptic transmission
GO:0008152 P metabolic process
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016787 F hydrolase activity
GO:0019725 P cellular homeostasis
GO:0031122 P cytoplasmic microtubule organization
GO:0031307 C integral component of mitochondrial outer membrane
GO:0034643 P establishment of mitochondrion localization, microtubule-mediated
GO:0046872 F metal ion binding
GO:0047497 P mitochondrion transport along microtubule
GO:0048489 P synaptic vesicle transport
GO:0051646 P mitochondrion localization
GO:0097345 P mitochondrial outer membrane permeabilization
RNA-seq EntryA_BomoFB_comp100437_c0_seq1
Sequence
(Amino Acid)
MVYETVPRTVRILLLGEPGVGKTSLILSLVTEEFTEHVPPKAEEITIPADVTPEQVPTNI
IDICIPEQSLEQVAEEIERAHVICIVFSVDRQETLNKIATYWLPFVRDNCPEDYRKPVIL
VGNKIDLIDYSVIDNIWDIAEEYPEVDRCIECSAKSLINVSEMFYNAQKAVLHPINPIYS
IEEQELTEKCKKALSRIFKICDLDGDGLLDDYEV
(70 a.a.)

- SilkBase 1999-2023 -