SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB19412_3prime_partial:A_BomoFB_comp100176_c0_seq1
Scaffold_idBomo_Chr4
NCBI non-redundant
(nr)
Ontology
GO:0003700 F DNA-binding transcription factor activity
GO:0004402 F histone acetyltransferase activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005669 C transcription factor TFIID complex
GO:0005730 C nucleolus
GO:0006351 P transcription, DNA-templated
GO:0006352 P DNA-templated transcription, initiation
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006367 P transcription initiation from RNA polymerase II promoter
GO:0006368 P transcription elongation from RNA polymerase II promoter
GO:0015629 C actin cytoskeleton
GO:0016032 P viral process
GO:0016568 P chromatin organization
GO:0016573 P histone acetylation
GO:0033276 C transcription factor TFTC complex
GO:0042795 P snRNA transcription by RNA polymerase II
GO:0043231 C intracellular membrane-bounded organelle
GO:0044212 F transcription cis-regulatory region binding
GO:0046983 F protein dimerization activity
GO:1901796 P regulation of signal transduction by p53 class mediator
RNA-seq EntryA_BomoFB_comp100176_c0_seq1
Sequence
(Amino Acid)
MSEKSTPLLAVLQLLRKYNLKSTEDILRKEASLGDVECESLDLPEVELASILTAHHTESD
PFTYELAYDGLKKFIENSLDLYKYELSTLLYPVFVHMYLLLILYDHVEHAVSFLEKFGIE
QEDYYQEDLKKLSIVKHKDQIKGNE
(47 a.a.)

- SilkBase 1999-2023 -