SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB16672_complete:A_BomoFB_comp11334_c0_seq1
Scaffold_idBomo_Chr11
NCBI non-redundant
(nr)
Ontology
GO:0000276 C mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)
GO:0005739 C mitochondrion
GO:0005743 C mitochondrial inner membrane
GO:0005811 C lipid droplet
GO:0005875 C microtubule associated complex
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006979 P response to oxidative stress
GO:0008340 P determination of adult lifespan
GO:0015078 F proton transmembrane transporter activity
GO:0015986 P ATP synthesis coupled proton transport
GO:0015992 P proton transmembrane transport
GO:0016020 C membrane
GO:0032007 P negative regulation of TOR signaling
GO:0045263 C proton-transporting ATP synthase complex, coupling factor F(o)
GO:0046034 P ATP metabolic process
GO:0046933 F proton-transporting ATP synthase activity, rotational mechanism
GO:0051881 P regulation of mitochondrial membrane potential
GO:0070373 P negative regulation of ERK1 and ERK2 cascade
RNA-seq EntryA_BomoFB_comp11334_c0_seq1
Sequence
(Amino Acid)
MAKRISQSAVNWAALAERVPAEQKAHLAAFKIKSDNYLRRVLANPPEPPKINWAVYKQAV
PIPGMVDTFQKQYEALKIPYPADTQTALVESQWNQVKNAIDAFIQESNANIASYQKEINA
TKALLPYDQMTMEDFYDAHPDLALDPIKKPTFWPHTPEEQLDYVDPEKQAQPTTAAAAH
*(59 a.a.)

- SilkBase 1999-2023 -