SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoFB16460_complete:A_BomoFB_comp10619_c0_seq1
Scaffold_idBomo_Chr15
NCBI non-redundant
(nr)
Ontology
GO:0000166 F nucleotide binding
GO:0000287 F magnesium ion binding
GO:0004550 F nucleoside diphosphate kinase activity
GO:0005524 F ATP binding
GO:0005525 F GTP binding
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0005874 C microtubule
GO:0005875 C microtubule associated complex
GO:0005880 C nuclear microtubule
GO:0005886 C plasma membrane
GO:0006163 P purine nucleotide metabolic process
GO:0006165 P nucleoside diphosphate phosphorylation
GO:0006183 P GTP biosynthetic process
GO:0006220 P pyrimidine nucleotide metabolic process
GO:0006228 P UTP biosynthetic process
GO:0006241 P CTP biosynthetic process
GO:0006468 P protein phosphorylation
GO:0007017 P microtubule-based process
GO:0007067 P mitotic cell cycle
GO:0007424 P open tracheal system development
GO:0007427 P epithelial cell migration, open tracheal system
GO:0008017 F microtubule binding
GO:0009117 P nucleotide metabolic process
GO:0009142 P nucleoside triphosphate biosynthetic process
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016334 P establishment or maintenance of polarity of follicular epithelium
GO:0016740 F transferase activity
GO:0018105 P peptidyl-serine phosphorylation
GO:0034332 P adherens junction organization
GO:0035152 P regulation of tube architecture, open tracheal system
GO:0046777 P protein autophosphorylation
GO:0046872 F metal ion binding
RNA-seq EntryA_BomoFB_comp10619_c0_seq1
Sequence
(Amino Acid)
MMAEQRERTFIMVKPDGVQRGLVGTIIERFEKKGFKLVGLKFVWPSEELLQQHYSDLASR
PFFPGLVKYMSSGPVVPMVWEGLNVVKTGRQMLGATNPADSQPGTIRGDLCIQVGRNIIH
GSDSVESAKKEIGLWFTDKEVVGWTPANENWVYE
*(50 a.a.)

- SilkBase 1999-2023 -