SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB16340_internal:A_BomoFB_comp10565_c0_seq5
Scaffold_idBomo_Chr20
NCBI non-redundant
(nr)
Ontology
GO:0000155 F phosphorelay sensor kinase activity
GO:0000160 P phosphorelay signal transduction system
GO:0000166 F nucleotide binding
GO:0004673 F protein histidine kinase activity
GO:0005515 F protein binding
GO:0005524 F ATP binding
GO:0005622 C intracellular anatomical structure
GO:0005886 C plasma membrane
GO:0006355 P regulation of transcription, DNA-templated
GO:0007049 P cell cycle
GO:0007165 P signal transduction
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016301 F kinase activity
GO:0016310 P phosphorylation
GO:0016740 F transferase activity
GO:0016772 F transferase activity, transferring phosphorus-containing groups
GO:0018106 P peptidyl-histidine phosphorylation
GO:0023014 P signal transduction
GO:0030154 P cell differentiation
RNA-seq EntryA_BomoFB_comp10565_c0_seq5
Sequence
(Amino Acid)
ENDHVNTVHVIQTKNDFTLQSRLSCEHGNSTPTFESKCLFDLKEDAMKMSKNKPQGRNLK
DSLKQPNISEIQTDVNKTTNRINSDISNTMNNTLFLESKSGVQSETRT
(35 a.a.)

- SilkBase 1999-2023 -