SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB14712_complete:A_BomoFB_comp10515_c0_seq1
Scaffold_idBomo_Chr7
NCBI non-redundant
(nr)
ubiquitin-conjugating_enzyme_rad6_[Culex_quinquefasciatus]
Ontology
GO:0000166 F nucleotide binding
GO:0000209 P protein polyubiquitination
GO:0000422 P autophagy of mitochondrion
GO:0000790 C chromatin
GO:0002039 F p53 binding
GO:0004842 F ubiquitin-protein transferase activity
GO:0005524 F ATP binding
GO:0005634 C nucleus
GO:0005737 C cytoplasm
GO:0006281 P DNA repair
GO:0006974 P cellular response to DNA damage stimulus
GO:0007052 P mitotic spindle organization
GO:0016567 P protein ubiquitination
GO:0016574 P histone ubiquitination
GO:0016740 F transferase activity
GO:0019904 F protein domain specific binding
GO:0031625 F ubiquitin protein ligase binding
GO:0032436 P positive regulation of proteasomal ubiquitin-dependent protein catabolic process
GO:0032456 P endocytic recycling
GO:0033503 C HULC complex
GO:0042787 P ubiquitin-dependent protein catabolic process
GO:0043066 P negative regulation of apoptotic process
GO:0043161 P proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043518 P negative regulation of DNA damage response, signal transduction by p53 class mediator
GO:0051297 P centrosome cycle
GO:0051299 P centrosome separation
GO:0061630 F ubiquitin protein ligase activity
GO:0061631 F ubiquitin conjugating enzyme activity
GO:1902166 P negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
RNA-seq EntryA_BomoFB_comp10515_c0_seq1
Sequence
(Amino Acid)
MIWNAVIFGPHDTPFEDGTFKLTIEFTEEYPNKPPTVRFVSKMFHPNVYADGGICLDILQ
NRWSPTYDVSAILTSIQSLLSDPNPNSPANSMAAQLYKENRREYEKRVKACVEQSFID
*(38 a.a.)

- SilkBase 1999-2023 -