SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB14443_complete:A_BomoFB_comp10491_c0_seq23
Scaffold_idBomo_Chr5
NCBI non-redundant
(nr)
hypothetical_protein_SINV_14695,_partial_[Solenopsis_invicta]
Ontology
GO:0000166 F nucleotide binding
GO:0001726 C ruffle
GO:0001889 P liver development
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005737 C cytoplasm
GO:0005768 C endosome
GO:0005794 C Golgi apparatus
GO:0005886 C plasma membrane
GO:0005925 C focal adhesion
GO:0005938 C cell cortex
GO:0006810 P transport
GO:0007264 P small GTPase mediated signal transduction
GO:0007399 P nervous system development
GO:0010008 C endosome membrane
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0030139 C endocytic vesicle
GO:0030154 P cell differentiation
GO:0030838 P positive regulation of actin filament polymerization
GO:0030866 P cortical actin cytoskeleton organization
GO:0031527 C filopodium membrane
GO:0031529 P ruffle organization
GO:0031996 F thioesterase binding
GO:0033028 P myeloid cell apoptotic process
GO:0034394 P protein localization to cell surface
GO:0035020 P regulation of Rac protein signal transduction
GO:0036010 P protein localization to endosome
GO:0042995 C cell projection
GO:0043209 C myelin sheath
GO:0047485 F protein N-terminus binding
GO:0051489 P regulation of filopodium assembly
GO:0055038 C recycling endosome membrane
GO:0060998 P regulation of dendritic spine development
GO:0070062 C extracellular exosome
GO:0090004 P positive regulation of protein localization to plasma membrane
GO:0090162 P establishment of epithelial cell polarity
GO:0097284 P hepatocyte apoptotic process
RNA-seq EntryA_BomoFB_comp10491_c0_seq23
Sequence
(Amino Acid)
MGKLLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFN
VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF
ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATTGDGLYEGLTWLTSNHKL
*(57 a.a.)

- SilkBase 1999-2023 -