SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB14388_complete:A_BomoFB_comp10485_c0_seq19
Scaffold_idBomo_Scaf008
NCBI non-redundant
(nr)
PREDICTED:_tetraspanin_E118_isoform_X1_[Bombyx_mori]
Ontology
GO:0005178 F integrin binding
GO:0005515 F protein binding
GO:0005576 C extracellular region
GO:0005615 C extracellular space
GO:0005886 C plasma membrane
GO:0005887 C integral component of plasma membrane
GO:0005925 C focal adhesion
GO:0006928 P movement of cell or subcellular component
GO:0007155 P cell adhesion
GO:0007166 P cell surface receptor signaling pathway
GO:0007338 P single fertilization
GO:0007342 P fusion of sperm to egg plasma membrane involved in single fertilization
GO:0007420 P brain development
GO:0008285 P negative regulation of cell population proliferation
GO:0009414 P response to water deprivation
GO:0009897 C external side of plasma membrane
GO:0009986 C cell surface
GO:0014003 P oligodendrocyte development
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0016324 C apical plasma membrane
GO:0030913 P paranodal junction assembly
GO:0031623 P receptor internalization
GO:0070062 C extracellular exosome
GO:0071404 P cellular response to low-density lipoprotein particle stimulus
GO:1903561 C extracellular vesicle
RNA-seq EntryA_BomoFB_comp10485_c0_seq19
Sequence
(Amino Acid)
MIVGGIAFVIAFFGCCGAIRESNCMLVTYAIFMLVLMALKLTLGVMVFVNLDGVVAAIPN
WMNKTFQQDQDTFHVIEHRFSCCGPTGPGSYLSLTLPITCCSTTPCTVINAYAGCTEVLQ
ALFNNYGVAIGSVAIVIAAIELVAVIFALCLANHARNKMRRSRY
*(54 a.a.)

- SilkBase 1999-2023 -