SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB14030_5prime_partial:A_BomoFB_comp10446_c3_seq47
Scaffold_idBomo_Chr28
NCBI non-redundant
(nr)
PREDICTED:_nuclear_pore_glycoprotein_p62_isoform_X2_[Papilio_xuthus]
Ontology
GO:0000922 C spindle pole
GO:0003682 F chromatin binding
GO:0005487 F structural constituent of nuclear pore
GO:0005515 F protein binding
GO:0005543 F phospholipid binding
GO:0005634 C nucleus
GO:0005635 C nuclear envelope
GO:0005642 C annulate lamellae
GO:0005643 C nuclear pore
GO:0005737 C cytoplasm
GO:0005856 C cytoskeleton
GO:0006351 P transcription, DNA-templated
GO:0006405 P RNA export from nucleus
GO:0006406 P mRNA export from nucleus
GO:0006409 P tRNA export from nucleus
GO:0006606 P protein import into nucleus
GO:0006810 P transport
GO:0007067 P mitotic cell cycle
GO:0007077 P mitotic nuclear membrane disassembly
GO:0007166 P cell surface receptor signaling pathway
GO:0007283 P spermatogenesis
GO:0007569 P cell aging
GO:0008219 P cell death
GO:0008285 P negative regulation of cell population proliferation
GO:0009755 P hormone-mediated signaling pathway
GO:0009966 P regulation of signal transduction
GO:0010827 P regulation of glucose transmembrane transport
GO:0015031 P protein transport
GO:0016032 P viral process
GO:0016925 P protein sumoylation
GO:0017056 F structural constituent of nuclear pore
GO:0019083 P viral transcription
GO:0019894 F kinesin binding
GO:0030159 F signaling receptor complex adaptor activity
GO:0030529 C ribonucleoprotein complex
GO:0030544 F Hsp70 protein binding
GO:0031047 P gene silencing by RNA
GO:0031074 C nucleocytoplasmic transport complex
GO:0031965 C nuclear membrane
GO:0042059 P negative regulation of epidermal growth factor receptor signaling pathway
GO:0042169 F SH2 domain binding
GO:0042306 P regulation of protein import into nucleus
GO:0043066 P negative regulation of apoptotic process
GO:0043069 P negative regulation of programmed cell death
GO:0043123 P positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043130 F ubiquitin binding
GO:0043231 C intracellular membrane-bounded organelle
GO:0043234 C protein-containing complex
GO:0043407 P negative regulation of MAP kinase activity
GO:0044613 C nuclear pore central transport channel
GO:0045742 P positive regulation of epidermal growth factor receptor signaling pathway
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0046578 P regulation of Ras protein signal transduction
GO:0046580 P negative regulation of Ras protein signal transduction
GO:0046930 C pore complex
GO:0046966 F thyroid hormone receptor binding
GO:0051028 P mRNA transport
GO:0051169 P nuclear transport
GO:0051425 F PTB domain binding
GO:0051879 F Hsp90 protein binding
GO:0070208 P protein heterotrimerization
GO:0071426 P obsolete ribonucleoprotein complex export from nucleus
GO:0075733 P intracellular transport of virus
GO:0090543 C Flemming body
GO:1900034 P regulation of cellular response to heat
RNA-seq EntryA_BomoFB_comp10446_c3_seq47
Sequence
(Amino Acid)
TPSTQTTGLSFGVSSTPSTQTTGLSFGVSSTPSTQTSGLGFGVSSAPSTQATGLSFGVSS
APSTQATALSFGVSSATTQPPSTGINFGTGTSAGLTFGTKTVTTTAVSSAPSTTTPSGIT
ALGKTTASTSIMPTLTATTTAAAPVPPQPITSITFAQLEENINKWTLELEEQERTFINQA
TQINAWDTLLIANGEKIVELNEAVETVKNEQQSLEHELDFVLAQQKELEDLLGPMEKQLL
QENNDRIKDPEREHMYSLAENLDSQLHQMSEDLKEVIEHLNETNRSQDGNDPIVQIGRIL
NAHMSSMHWIDNSIAQISNKLDQLKSVHDTLRKDNERSFQLTYN
*(114 a.a.)

- SilkBase 1999-2023 -