SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB13427_complete:A_BomoFB_comp10374_c0_seq18
Scaffold_idBomo_Scaf001
NCBI non-redundant
(nr)
ras-related_GTP-binding_protein_Rab11_[Bombyx_mori]
Ontology
GO:0000166 F nucleotide binding
GO:0000910 P cytokinesis
GO:0000922 C spindle pole
GO:0003924 F GTPase activity
GO:0005525 F GTP binding
GO:0005622 C intracellular anatomical structure
GO:0005737 C cytoplasm
GO:0005739 C mitochondrion
GO:0005768 C endosome
GO:0005771 C multivesicular body
GO:0005794 C Golgi apparatus
GO:0005802 C trans-Golgi network
GO:0005813 C centrosome
GO:0005828 C kinetochore microtubule
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006887 P exocytosis
GO:0006913 P nucleocytoplasmic transport
GO:0007049 P cell cycle
GO:0007080 P mitotic metaphase plate congression
GO:0007165 P signal transduction
GO:0007264 P small GTPase mediated signal transduction
GO:0008017 F microtubule binding
GO:0008152 P metabolic process
GO:0010634 P positive regulation of epithelial cell migration
GO:0010796 P regulation of multivesicular body size
GO:0010971 P positive regulation of G2/M transition of mitotic cell cycle
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016192 P vesicle-mediated transport
GO:0030133 C transport vesicle
GO:0030424 C axon
GO:0030953 P astral microtubule organization
GO:0031175 P neuron projection development
GO:0031410 C cytoplasmic vesicle
GO:0031489 F myosin V binding
GO:0031982 C vesicle
GO:0032154 C cleavage furrow
GO:0032402 P melanosome transport
GO:0036258 P multivesicular body assembly
GO:0043234 C protein-containing complex
GO:0045335 C phagocytic vesicle
GO:0045773 P positive regulation of axon extension
GO:0048169 P regulation of long-term neuronal synaptic plasticity
GO:0048471 C perinuclear region of cytoplasm
GO:0051223 P regulation of protein transport
GO:0051650 P establishment of vesicle localization
GO:0055037 C recycling endosome
GO:0055038 C recycling endosome membrane
GO:0060627 P regulation of vesicle-mediated transport
GO:0070062 C extracellular exosome
GO:0072594 P establishment of protein localization to organelle
GO:0072659 P protein localization to plasma membrane
GO:0090150 P establishment of protein localization to membrane
GO:0090307 P mitotic spindle assembly
GO:1990182 P exosomal secretion
RNA-seq EntryA_BomoFB_comp10374_c0_seq18
Sequence
(Amino Acid)
MGTREDEYDYLFKVVLIGDSGVGKSSLLSRFTRNEFNLESKSTIGVEFATRSIEVDGKTI
KAQIWDTAGQERYRAITSAYYRGAVGALLVYDIAKHLSYENVERWLRELRDHADQNILIM
LVGNKSDLRHLRSIPTEEAKAFAEANGLSFIETSALDSTNVEPAFQNILTEIYRIVSQRQ
MRDPPEGDVIRPDAEPADVRPSQADSVRRQCCQ
*(70 a.a.)

- SilkBase 1999-2023 -