SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB12800_complete:A_BomoFB_comp10292_c0_seq11
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)
PREDICTED:_transient_receptor_potential_cation_channel_subfamily_A_member_1_isoform_X1_[Bombyx_mori]
Ontology
GO:0001580 P detection of chemical stimulus involved in sensory perception of bitter taste
GO:0005216 F ion channel activity
GO:0005261 F cation channel activity
GO:0005886 C plasma membrane
GO:0006810 P transport
GO:0006811 P ion transport
GO:0006812 P cation transport
GO:0006816 P calcium ion transport
GO:0007602 P phototransduction
GO:0007638 P mechanosensory behavior
GO:0009408 P response to heat
GO:0009416 P response to light stimulus
GO:0010378 P temperature compensation of the circadian clock
GO:0015276 F ligand-gated ion channel activity
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0019233 P sensory perception of pain
GO:0023041 P neuronal signal transduction
GO:0033038 F bitter taste receptor activity
GO:0034220 P ion transmembrane transport
GO:0034605 P cellular response to heat
GO:0034703 C cation channel complex
GO:0040040 P thermosensory behavior
GO:0043052 P thermotaxis
GO:0046957 P negative phototaxis
GO:0050850 P positive regulation of calcium-mediated signaling
GO:0050896 P response to stimulus
GO:0050960 P detection of temperature stimulus involved in thermoception
GO:0050965 P detection of temperature stimulus involved in sensory perception of pain
GO:0050968 P detection of chemical stimulus involved in sensory perception of pain
GO:0055085 P transmembrane transport
GO:0097604 F temperature-gated cation channel activity
GO:0098655 P cation transmembrane transport
RNA-seq EntryA_BomoFB_comp10292_c0_seq11
Sequence
(Amino Acid)
MDEDGTRKSQQAQQIPLPALNAMVAHGRVELLAHPLSQKYLQMKWNSYGKYFHLVNVLFY
CIFLIFVTVYSYLLMEHVNPINKRERSRVGDVYYNYTATNRTQTNWDIDADFEAILIMYT
SSVVIMVYISVCMMREAYNLKQQKWHYIVDPSNLVSWTLYISATITVFPTLYGHYSNYQF
SAASITVFLSWFELLLLLQRFDQVGIYVVMFLEILQTLIKVLMVFSILIIAFGLAFYILL
SKVGSVEMVFINFTTLGESPFFQQHPYCFDENIRYDAW
*(92 a.a.)

- SilkBase 1999-2023 -