SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoFB12471_complete:A_BomoFB_comp10206_c0_seq2
Scaffold_idBomo_Chr13
NCBI non-redundant
(nr)		PREDICTED:_sterol_regulatory_element-binding_protein_2_[Amyelois_transitella]
Ontology
GO:0000122 P negative regulation of transcription by RNA polymerase II
GO:0000139 C Golgi membrane
GO:0000978 F RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0000982 F DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001077 F DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0003062 P regulation of heart rate by chemical signal
GO:0003677 F DNA binding
GO:0003682 F chromatin binding
GO:0003700 F DNA-binding transcription factor activity
GO:0005515 F protein binding
GO:0005634 C nucleus
GO:0005654 C nucleoplasm
GO:0005737 C cytoplasm
GO:0005783 C endoplasmic reticulum
GO:0005789 C endoplasmic reticulum membrane
GO:0005794 C Golgi apparatus
GO:0006351 P transcription, DNA-templated
GO:0006355 P regulation of transcription, DNA-templated
GO:0006366 P transcription by RNA polymerase II
GO:0006629 P lipid metabolic process
GO:0007568 P aging
GO:0007623 P circadian rhythm
GO:0008202 P steroid metabolic process
GO:0008203 P cholesterol metabolic process
GO:0008286 P insulin receptor signaling pathway
GO:0008610 P lipid biosynthetic process
GO:0009267 P cellular response to starvation
GO:0009749 P response to glucose
GO:0010867 P positive regulation of triglyceride biosynthetic process
GO:0012507 C ER to Golgi transport vesicle membrane
GO:0014070 P response to organic cyclic compound
GO:0016020 C membrane
GO:0016021 C integral component of membrane
GO:0019217 P regulation of fatty acid metabolic process
GO:0019901 F protein kinase binding
GO:0030324 P lung development
GO:0031065 P positive regulation of histone deacetylation
GO:0031410 C cytoplasmic vesicle
GO:0031647 P regulation of protein stability
GO:0032094 P response to food
GO:0032403 F protein-containing complex binding
GO:0032526 P response to retinoic acid
GO:0032570 P response to progesterone
GO:0032810 F sterol response element binding
GO:0032869 P cellular response to insulin stimulus
GO:0033762 P response to glucagon
GO:0033993 P response to lipid
GO:0042493 P response to xenobiotic stimulus
GO:0042789 P mRNA transcription by RNA polymerase II
GO:0043231 C intracellular membrane-bounded organelle
GO:0043234 C protein-containing complex
GO:0043434 P response to peptide hormone
GO:0043565 F sequence-specific DNA binding
GO:0044212 F transcription cis-regulatory region binding
GO:0045444 P fat cell differentiation
GO:0045542 P positive regulation of cholesterol biosynthetic process
GO:0045723 P positive regulation of fatty acid biosynthetic process
GO:0045893 P positive regulation of transcription, DNA-templated
GO:0045944 P positive regulation of transcription by RNA polymerase II
GO:0046676 P negative regulation of insulin secretion
GO:0046983 F protein dimerization activity
GO:0050796 P regulation of insulin secretion
GO:0051591 P response to cAMP
GO:0070542 P response to fatty acid
GO:0071398 P cellular response to fatty acid
GO:1903146 P regulation of autophagy of mitochondrion
GO:1903214 P regulation of protein targeting to mitochondrion
RNA-seq EntryA_BomoFB_comp10206_c0_seq2
Sequence
(Amino Acid)
MDIDPFMNADVFNVHDIAEIEDFLNNCDGDFMTKLEQELTFVDNTNETGLLDIDTKCKPE
ISSSPQVSPNYNHTGNPVMSQHTHRIRPTPPISKTIQGGYIKEEKFNLPTSLENASVTFP
EVIPQQRTQVQNQPMIFQQVVQSPVFVNLGPAGNIQPMPDKRSNVIQVDNVPQVNKTSPL
KQQSQPLLIQNNPKGVPFILKSSDSNFSPVLLQSNIINPKTQTLMYTSTPLQVSSTNQNI
ITNAKAGSETTPIHTFFTNSNGTTLLTGIPAVVLEGDKIALNPAPNIGPPKVKEVKRSAH
NAIERRYRTSINDRIVELKNMLVGEEAKLNKSAILRKTIEYIKYLRSQNTRLKQENIALK
QVCQKSGVKEPIFEGGYTPPHSDVSSPYHSPHSIDSDTPSSPEYKTEDKYSKIVMGMGDH
SRLALCAFMVGLIAFNPFSTFFSSFTTEYTTTDFNARIDQRKILSEDDSSYEGSSWAICV
FNTFFIYLVNFVILGGCLVKLLVYGDSVPKSQSKEAGLFYKHKRLAGNHLKKGDLNNTRL
ELHRALEACGRSVQAGGPGQAKYTALTAAVLRQLLQRLPFGGFLARRAGDLWRDSPTRRA
TLHWATEVSSVSHQLAQLEILSDHRGRSERLLLALQAINLAEVAGNRQLLADTYVTAALV
FKDYMPKIGNWLCGYYLRACRSASAESCGGWSACSVRVRWAASARGQHFLRTQRWSYDSD
HPPAKLFSRLPDPADPLAYAMRAYHLEILQRSLQMLLCADERTNTRDVLDLVKLITDDVS
TDAPQHTGCWDPVMEWWANIVGVAATWLLAETGRAVDIADRLDLLPESLINCEDPLPGCG
FVYF
*(280 a.a.)

- SilkBase 1999-2023 -