SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18

ORF from Assembled RNA_seq Entry

NameO_BomoFB12160_3prime_partial:A_BomoFB_comp10163_c0_seq2
Scaffold_idBomo_Chr1
NCBI non-redundant
(nr)		PREDICTED:_laminin_subunit_alpha_[Bombyx_mori]
Ontology
GO:0001964 P startle response
GO:0002121 P inter-male aggressive behavior
GO:0005102 F signaling receptor binding
GO:0005576 C extracellular region
GO:0005578 C extracellular matrix
GO:0005604 C basement membrane
GO:0005605 C basement membrane
GO:0007155 P cell adhesion
GO:0007411 P axon guidance
GO:0007417 P central nervous system development
GO:0007422 P peripheral nervous system development
GO:0007476 P imaginal disc-derived wing morphogenesis
GO:0007498 P mesoderm development
GO:0007507 P heart development
GO:0008021 C synaptic vesicle
GO:0009887 P animal organ morphogenesis
GO:0009888 P tissue development
GO:0010906 P regulation of glucose metabolic process
GO:0016321 P female meiosis chromosome segregation
GO:0030054 C cell junction
GO:0030155 P regulation of cell adhesion
GO:0030334 P regulation of cell migration
GO:0030424 C axon
GO:0031410 C cytoplasmic vesicle
GO:0031987 P locomotion involved in locomotory behavior
GO:0033627 P cell adhesion mediated by integrin
GO:0034446 P substrate adhesion-dependent cell spreading
GO:0035001 P dorsal trunk growth, open tracheal system
GO:0035011 P melanotic encapsulation of foreign target
GO:0036062 C presynaptic periactive zone
GO:0042995 C cell projection
GO:0045202 C synapse
GO:0045886 P negative regulation of synaptic assembly at neuromuscular junction
GO:0045995 P regulation of embryonic development
GO:0048598 P embryonic morphogenesis
GO:0048854 P brain morphogenesis
RNA-seq EntryA_BomoFB_comp10163_c0_seq2
Sequence
(Amino Acid)
MDFKDKADSFFTTQRLNYISNQTELLRPKVAQLKTVDIGEVTSSIKTLETSAKNLLRSAE
FAATDSDKQISRAAKLAEDAERTLAAVRESAREATEVVKHVADLATGLELSQQPKVDSAL
TEARQIRDDIADKDLVPKKQQAEAVFLNTTTQIERMNFFVQPVNEQAKKFESLVNATREL
KDKLDDMLEYTDLAQHTAHTAEELNTKNRLSKFGNKVNSVTKLNTAAMGDLIDAAYDIGN
ATYNNMAVGARLAGAGR
(84 a.a.)

- SilkBase 1999-2023 -