SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
NameO_BomoFB12127_complete:A_BomoFB_comp10151_c0_seq1
Scaffold_idBomo_Scaf056
NCBI non-redundant
(nr)
PREDICTED:_ras-related_protein_Rab-35_[Papilio_polytes]
Ontology
GO:0000139 C Golgi membrane
GO:0000166 F nucleotide binding
GO:0000910 P cytokinesis
GO:0003924 F GTPase activity
GO:0005525 F GTP binding
GO:0005546 F phosphatidylinositol-4,5-bisphosphate binding
GO:0005622 C intracellular anatomical structure
GO:0005739 C mitochondrion
GO:0005768 C endosome
GO:0005789 C endoplasmic reticulum membrane
GO:0005886 C plasma membrane
GO:0005905 C clathrin-coated pit
GO:0006810 P transport
GO:0006886 P intracellular protein transport
GO:0006888 P endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0006913 P nucleocytoplasmic transport
GO:0007165 P signal transduction
GO:0007264 P small GTPase mediated signal transduction
GO:0008104 P protein localization
GO:0008152 P metabolic process
GO:0010008 C endosome membrane
GO:0015031 P protein transport
GO:0016020 C membrane
GO:0016197 P endosomal transport
GO:0019003 F GDP binding
GO:0019882 P antigen processing and presentation
GO:0030136 C clathrin-coated vesicle
GO:0031175 P neuron projection development
GO:0031253 C cell projection membrane
GO:0031410 C cytoplasmic vesicle
GO:0032456 P endocytic recycling
GO:0036010 P protein localization to endosome
GO:0042470 C melanosome
GO:0045171 C intercellular bridge
GO:0045334 C clathrin-coated endocytic vesicle
GO:0048227 P plasma membrane to endosome transport
GO:0070062 C extracellular exosome
GO:1990090 P cellular response to nerve growth factor stimulus
RNA-seq EntryA_BomoFB_comp10151_c0_seq1
Sequence
(Amino Acid)
MAREFDHLFKLLIIGDSGVGKSCLLLRFADNTFSGSYITTIGVDFKIRTLEVNGEKVKLQ
IWDTAGQERFRTITSTYYRGTHGVIVVYDVTNGESFANVKRWLHEIEQNCDVVNKVLVGN
KNDCPSRKVVVTEDAQRFASQMNIPLFETSAKENINVEEMFLTITKMVLKSKLEMKERQN
VTSNDTVNLKKGNHKIKKKCC
*(66 a.a.)

- SilkBase 1999-2023 -